/eh/2025-01-08/173633966714069467/picture.png)
/eh/2024-12-24/173503345348979036/Favorite-Icon.png){kind=icon}
/eh/2025-07-08/1751962110204480194/picture.png)
/eh/2025-06-21/1750485478958537574/countryInfoIcon.png)
/eh/2025-06-21/1750485741321434291/Hi-Sign-in-My-Nihao.png)
/eh/2025-06-21/1750485837193896318/cart.png)
/eh/2025-06-21/1750485968202533847/cart.png)
/eh/2025-04-17/1744862476612819675/hot-img.png)
/eh/2025-11-07/1762504524550532584/header-icon.jpg){kind=icon}
/eh/2025-07-07/1751875582852206790/header-icon.png){kind=icon}
/eh/2025-07-07/1751875587886277738/header-icon.png){kind=icon}
Tesamorelin/Ipamorelin Research Material
US$ 29.06
home
>
is bac water safe What Bacteriostatic Water? π Bacteriostatic is a sterile, preserved solution designed for multi-dose vials. It contains 0.9% benzyl alcohol, which inhibits bacterial growth and allows for repeated use. Common Aqua Science
>
is bac water safe What Bacteriostatic Water? π Bacteriostatic is a sterile, preserved solution designed for multi-dose vials. It contains 0.9% benzyl alcohol, which inhibits bacterial growth and allows for repeated use. Common Aqua Science
download picture
description
is bac water safe What Bacteriostatic Water? π Bacteriostatic is a sterile, preserved solution designed for multi-dose vials. It contains 0.9% benzyl alcohol, which inhibits bacterial growth and allows for repeated use. Common Aqua Science
Shopping security
product description
Why choose thelockerguy wholesale?
is bac water safe What Bacteriostatic Water? π Bacteriostatic is a sterile, preserved solution designed for multi-dose vials. It contains 0.9% benzyl alcohol, which inhibits bacterial growth and allows for repeated use. Common Aqua Science
Caffeine stimulating scalp treatment
The procedure is quick and causes minimal discomfort, similar to a routine vaccination
Aqua Science
Size:16oz Glass Bottle
Product Specifications Test Results Sample: Tesa, Ipamorelin, CJC 1295 6/3/3mg Tesa Properties Source: PubChem Form: Lyophilized powder Unit size: 6mg/vial Unit quantity: 1 vial Molecular formula: C 223 H 370 N 72 O 69 S Molecular weight: 5196 g/mol Synonym: Tesamorelin acetate Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL CAS number: 901758-09-6 Ipamorelin Properties Source: PubChem Form: Lyophilized powder Unit size: 3mg/vial Unit quantity: 1 vial Molecular formula: C 38 H 49 N 9 O 5 Molecular weight: 711.9 g/mol Sequence: Aib-His-D-2-Nal-D-Phe-Lys CAS number: 170851-70-4 CJC-1295 Properties Source: PubChem Form: Lyophilized powder Unit size: 3mg/vial Unit quantity: 1 vial Molecular formula: C 152 H 252 N 44 O 42 Molecular weight: 3367.9 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg CAS number: 863288-34-0 Frequently Asked Questions Related Products 3 of 48 products BPC-157 (10mg or 20mg) Tesamorelin SemagIutide (GLP-1 Analogue) How It Works Precision Synthesis Synthesized in dedicated, state of-the-art facilities
is bac water safe What Bacteriostatic Water? π Bacteriostatic is a sterile, preserved solution designed for multi-dose vials. It contains 0.9% benzyl alcohol, which inhibits bacterial growth and allows for repeated use. Common Aqua Science
Item no
:
12844584252
US$ 23.49
Pay in 4 interest-free payments of $5.87 Learn more
Min. order:
1piece
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours Β· Estimated delivery Oct 15 - Oct 20
US$40
Get nowSign up to your membership to get coupons up to
15%
Get nowOpportunity to enjoy order discount up to 15% off
Please add the products
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
Frequently Asked Questions for is bac water safe What Bacteriostatic Water? π Bacteriostatic is a sterile, preserved solution designed for multi-dose vials. It contains 0.9% benzyl alcohol, which inhibits bacterial growth and allows for repeated use. Common Aqua Science
How can I check an existing order's status without submitting another purchase?
Do not use a reorder action merely to find information about an earlier purchase. Ask the seller what an unfamiliar status label means for the specific order.
How can I check whether a seller-provided guarantee applies to the purchase?
Read what event or issue the guarantee actually covers. Ask for clarification when the listing and written terms seem inconsistent.
What should I review before approving a customized order preview?
Avoid sending contradictory comments about different versions in separate messages. Retain the seller's acknowledgment of your final response.
You may also like
Tesamorelin & CJC-1295 & Ipamorelin
US$ 26.22
Tesamorelin/Sermorelin
US$ 24.36
Tesamorelin vs. Ipamorelin
US$ 24.21
Tesamorelin Ipamorelin Blend 10mg
US$ 24.86
Tesamorelin
US$ 22.78
TESAMORELIN 5mg & 10mg | GH Peptide
US$ 24.35
Buy Tesamorelin 13mg | Ipamorelin 3mg
US$ 23.10
9 Health Benefits of Glutathione
US$ 28.81
Frontiers
US$ 26.15
L-Glutathione reduced
US$ 25.47